Lineage for d2otlp1 (2otl P:1-143)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093554Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1093555Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 1093556Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1093557Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1093558Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1093590Domain d2otlp1: 2otl P:1-143 [139361]
    Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1s72p_
    complexed with cd, cl, gir, k, mg, na

Details for d2otlp1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d2otlp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d2otlp1:

Click to download the PDB-style file with coordinates for d2otlp1.
(The format of our PDB-style files is described here.)

Timeline for d2otlp1: