Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L18e [52084] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries) Uniprot P12733 |
Domain d2otlo1: 2otl O:1-115 [139360] Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1ffkl_ complexed with cd, cl, gir, k, mg, na |
PDB Entry: 2otl (more details), 2.7 Å
SCOPe Domain Sequences for d2otlo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otlo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]} sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d2otlo1:
View in 3D Domains from other chains: (mouse over for more information) d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |