SCOPe 2.07: Domain d2otln1: 2otl N:1-186

Lineage for d2otln1 (2otl N:1-186)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein L18 (L18p) [53139] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
   Uniprot P14123

8. Domain d2otln1: 2otl N:1-186 [139359]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1ffkk_
   complexed with cd, cl, gir, k, mg, na

Details for d2otln1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d2otln1:

Sequence; same for both SEQRES and ATOM records:

>d2otln1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

Timeline for d2otln1:

• d2otln1 first appeared in SCOP 1.73
  
• d2otln1 appears in SCOPe 2.06
  
• d2otln1 appears in the current release, SCOPe 2.08