Lineage for d2otlj1 (2otl J:4-145)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114518Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2114519Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2114520Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2114521Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2114559Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 2114580Domain d2otlj1: 2otl J:4-145 [139355]
    Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1ffkg_
    complexed with cd, cl, gir, k, mg, na

Details for d2otlj1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d2otlj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d2otlj1:

Click to download the PDB-style file with coordinates for d2otlj1.
(The format of our PDB-style files is described here.)

Timeline for d2otlj1: