Lineage for d2otlh1 (2otl H:1-171)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721932Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 721933Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 721934Protein Ribosomal protein L10e [54688] (1 species)
  7. 721935Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries)
  8. 721953Domain d2otlh1: 2otl H:1-171 [139353]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1s72h_
    complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otlh1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOP Domain Sequences for d2otlh1:

Sequence, based on SEQRES records: (download)

>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscridsspagna

Sequence, based on observed residues (ATOM records): (download)

>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscridsspagna

SCOP Domain Coordinates for d2otlh1:

Click to download the PDB-style file with coordinates for d2otlh1.
(The format of our PDB-style files is described here.)

Timeline for d2otlh1: