Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
Protein Ribosomal protein L10e [54688] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries) |
Domain d2otlh1: 2otl H:1-171 [139353] Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1s72h_ complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2otl (more details), 2.7 Å
SCOP Domain Sequences for d2otlh1:
Sequence, based on SEQRES records: (download)
>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki vgtaarvqageqlftaycnvedaehvkeafrraynkitpscridsspagna
>d2otlh1 d.41.4.1 (H:1-171) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]} kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage qlftaycnvedaehvkeafrraynkitpscridsspagna
Timeline for d2otlh1:
View in 3D Domains from other chains: (mouse over for more information) d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |