Lineage for d2otlf1 (2otl F:1-119)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727288Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 727493Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 727494Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 727506Protein Ribosomal protein L7ae [55319] (4 species)
  7. 727510Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)
  8. 727528Domain d2otlf1: 2otl F:1-119 [139352]
    Other proteins in same PDB: d2otl11, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1s72f_
    complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otlf1

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d2otlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otlf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOP Domain Coordinates for d2otlf1:

Click to download the PDB-style file with coordinates for d2otlf1.
(The format of our PDB-style files is described here.)

Timeline for d2otlf1: