![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.141: Ribosomal protein L6 [56052] (1 superfamily) consists of two beta-sheets and one alpha-helix packed around single core |
![]() | Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) ![]() |
![]() | Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein) |
![]() | Protein Ribosomal protein L6 [56055] (6 species) duplication: consists of two domains of this fold |
![]() | Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries) Uniprot P14135 |
![]() | Domain d2otle2: 2otl E:80-172 [139351] Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 automatically matched to d1ffk12 complexed with cd, cl, gir, k, mg, na |
PDB Entry: 2otl (more details), 2.7 Å
SCOPe Domain Sequences for d2otle2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otle2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]} weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie avgqtaadieqltrindkdvrvfqdgvyitrkp
Timeline for d2otle2:
![]() Domains from other chains: (mouse over for more information) d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1 |