SCOP 1.75: Domain d2otle1: 2otl E:1-79

Lineage for d2otle1 (2otl E:1-79)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d2otle1: 2otl E:1-79 [139350]
   Other proteins in same PDB: d2otl11, d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
   automatically matched to d1ffk11
   complexed with 1ma, cd, cl, gir, k, mg, na, omg, omu, psu, ur3

Details for d2otle1

PDB Entry: 2otl, 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d2otle1:

Sequence; same for both SEQRES and ATOM records:

>d2otle1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

Timeline for d2otle1:

• d2otle1 first appeared in SCOP 1.73
  
• d2otle1 appears in SCOPe 2.01
  
• d2otle1 appears in the current release, SCOPe 2.07