Lineage for d2otl11 (2otl 1:1-56)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641696Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2641758Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 2641759Protein Ribosomal protein L37e [57834] (1 species)
  7. 2641760Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 2641794Domain d2otl11: 2otl 1:1-56 [139343]
    Other proteins in same PDB: d2otl21, d2otl31, d2otla1, d2otla2, d2otlb1, d2otlc1, d2otld1, d2otle1, d2otle2, d2otlf1, d2otlg1, d2otlh1, d2otli1, d2otlj1, d2otlk1, d2otll1, d2otlm1, d2otln1, d2otlo1, d2otlp1, d2otlq1, d2otlr1, d2otls1, d2otlt1, d2otlu1, d2otlv1, d2otlw1, d2otlx1, d2otly1, d2otlz1
    automatically matched to d1ffkx_
    complexed with cd, cl, gir, k, mg, na

Details for d2otl11

PDB Entry: 2otl (more details), 2.7 Å

PDB Description: girodazole bound to the large subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d2otl11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otl11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d2otl11:

Click to download the PDB-style file with coordinates for d2otl11.
(The format of our PDB-style files is described here.)

Timeline for d2otl11: