Lineage for d2otjy1 (2otj Y:95-236)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459800Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2459860Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 2459861Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 2459862Protein Ribosomal protein L32e [52044] (1 species)
  7. 2459863Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 2459912Domain d2otjy1: 2otj Y:95-236 [139341]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjz1
    automatically matched to d1jj2x_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjy1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOPe Domain Sequences for d2otjy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjy1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOPe Domain Coordinates for d2otjy1:

Click to download the PDB-style file with coordinates for d2otjy1.
(The format of our PDB-style files is described here.)

Timeline for d2otjy1: