Lineage for d2otjx1 (2otj X:7-88)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720856Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 720857Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 720858Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 720859Protein Ribosomal protein L31e [54577] (1 species)
  7. 720860Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
  8. 720882Domain d2otjx1: 2otj X:7-88 [139340]
    Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjy1, d2otjz1
    automatically matched to d1ffku_
    complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjx1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d2otjx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d2otjx1:

Click to download the PDB-style file with coordinates for d2otjx1.
(The format of our PDB-style files is described here.)

Timeline for d2otjx1: