| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.2: Long alpha-hairpin [46556] (19 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() |
| Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
| Protein Ribosomal protein L29 (L29p) [46563] (4 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries) |
| Domain d2otjv1: 2otj V:1-65 [139338] Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1ffks_ complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2otj (more details), 2.9 Å
SCOP Domain Sequences for d2otjv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otjv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd
Timeline for d2otjv1:
View in 3DDomains from other chains: (mouse over for more information) d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 |