![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries) Uniprot P10972 |
![]() | Domain d2otjt1: 2otj T:1-119 [139336] Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1ffkq_ complexed with 13t, cd, cl, k, mg, na |
PDB Entry: 2otj (more details), 2.9 Å
SCOPe Domain Sequences for d2otjt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otjt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
Timeline for d2otjt1:
![]() Domains from other chains: (mouse over for more information) d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 |