SCOP 1.73: Domain d2otjr1: 2otj R:1-150

Lineage for d2otjr1 (2otj R:1-150)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)

8. Domain d2otjr1: 2otj R:1-150 [139334]
   Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1ffko_
   complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3

Details for d2otjr1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d2otjr1:

Sequence; same for both SEQRES and ATOM records:

>d2otjr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d2otjr1:

• d2otjr1 is new in SCOP 1.73
  
• d2otjr1 appears in SCOP 1.75
  
• d2otjr1 appears in the current release, SCOPe 2.08