Lineage for d2otjp1 (2otj P:1-143)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919879Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 919880Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 919881Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 919882Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 919883Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 919919Domain d2otjp1: 2otj P:1-143 [139332]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1s72p_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjp1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d2otjp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d2otjp1:

Click to download the PDB-style file with coordinates for d2otjp1.
(The format of our PDB-style files is described here.)

Timeline for d2otjp1: