Lineage for d2otjo1 (2otj O:1-115)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460348Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 2460349Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 2460350Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 2460442Protein Ribosomal protein L18e [52084] (1 species)
  7. 2460443Species Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 2460479Domain d2otjo1: 2otj O:1-115 [139331]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1ffkl_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjo1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOPe Domain Sequences for d2otjo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOPe Domain Coordinates for d2otjo1:

Click to download the PDB-style file with coordinates for d2otjo1.
(The format of our PDB-style files is described here.)

Timeline for d2otjo1: