SCOPe 2.06: Domain d2otjm1: 2otj M:1-194

Lineage for d2otjm1 (2otj M:1-194)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d2otjm1: 2otj M:1-194 [139329]
   Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
   automatically matched to d1s72m_
   complexed with 13t, cd, cl, k, mg, na

Details for d2otjm1

PDB Entry: 2otj, 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d2otjm1:

Sequence; same for both SEQRES and ATOM records:

>d2otjm1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

Timeline for d2otjm1:

• d2otjm1 first appeared in SCOP 1.73
  
• d2otjm1 appears in SCOPe 2.05
  
• d2otjm1 appears in SCOPe 2.07
  
• d2otjm1 appears in the current release, SCOPe 2.08