Lineage for d2otjk1 (2otj K:1-132)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949112Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 949113Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 949114Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 949115Protein Ribosomal protein L14 [50195] (5 species)
  7. 949159Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 949181Domain d2otjk1: 2otj K:1-132 [139327]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otja2, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1s72k_
    complexed with 13t, cd, cl, k, mg, na

Details for d2otjk1

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d2otjk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otjk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d2otjk1:

Click to download the PDB-style file with coordinates for d2otjk1.
(The format of our PDB-style files is described here.)

Timeline for d2otjk1: