| Class b: All beta proteins [48724] (165 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (5 families) ![]() |
| Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
| Protein Ribosomal protein L3 [50462] (1 species) superfamily fold is elaborated with additional structures |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries) |
| Domain d2otjb1: 2otj B:1-337 [139318] Other proteins in same PDB: d2otj11, d2otj31, d2otja1, d2otja2, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 automatically matched to d1jj2b_ complexed with 13t, 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 2otj (more details), 2.9 Å
SCOP Domain Sequences for d2otjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2otjb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
Timeline for d2otjb1:
View in 3DDomains from other chains: (mouse over for more information) d2otj11, d2otj31, d2otja1, d2otja2, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1 |