Lineage for d2otja2 (2otj A:1-90)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950437Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 950555Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 950594Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
    Uniprot P20276
    includes the N-terminal tail
  8. 950616Domain d2otja2: 2otj A:1-90 [139317]
    Other proteins in same PDB: d2otj11, d2otj21, d2otj31, d2otja1, d2otjb1, d2otjc1, d2otjd1, d2otje1, d2otje2, d2otjf1, d2otjg1, d2otjh1, d2otji1, d2otjj1, d2otjk1, d2otjl1, d2otjm1, d2otjn1, d2otjo1, d2otjp1, d2otjq1, d2otjr1, d2otjs1, d2otjt1, d2otju1, d2otjv1, d2otjw1, d2otjx1, d2otjy1, d2otjz1
    automatically matched to d1s72a2
    complexed with 13t, cd, cl, k, mg, na

Details for d2otja2

PDB Entry: 2otj (more details), 2.9 Å

PDB Description: 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d2otja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otja2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap

SCOPe Domain Coordinates for d2otja2:

Click to download the PDB-style file with coordinates for d2otja2.
(The format of our PDB-style files is described here.)

Timeline for d2otja2: