Lineage for d2otha_ (2oth A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733387Species Daboia russellii [TaxId:97228] [186865] (27 PDB entries)
  8. 2733418Domain d2otha_: 2oth A: [139313]
    automated match to d1tgma_
    complexed with ccn, imn, nim

Details for d2otha_

PDB Entry: 2oth (more details), 2.9 Å

PDB Description: crystal structure of a ternary complex of phospholipase a2 with indomethacin and nimesulide at 2.9 a resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2otha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otha_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d2otha_:

Click to download the PDB-style file with coordinates for d2otha_.
(The format of our PDB-style files is described here.)

Timeline for d2otha_: