Lineage for d2otfa1 (2otf A:1-133)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649171Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 649172Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 649177Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 649265Protein Snake phospholipase A2 [48624] (35 species)
  7. 649425Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (47 PDB entries)
  8. 649456Domain d2otfa1: 2otf A:1-133 [139312]
    automatically matched to d1cl5a_
    complexed with 2tn

Details for d2otfa1

PDB Entry: 2otf (more details), 1.95 Å

PDB Description: crystal structure of the complex formed between phospholipase a2 and atenolol at 1.95 a resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOP Domain Sequences for d2otfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2otfa1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOP Domain Coordinates for d2otfa1:

Click to download the PDB-style file with coordinates for d2otfa1.
(The format of our PDB-style files is described here.)

Timeline for d2otfa1: