SCOPe 2.05: Domain d2ot3a_: 2ot3 A:

Lineage for d2ot3a_ (2ot3 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.222: VPS9 domain [109992] (1 superfamily)
   multihelical; consist of two subdomains

4. Superfamily a.222.1: VPS9 domain [109993] (1 family)

5. Family a.222.1.1: VPS9 domain [109994] (2 proteins)
   Pfam PF02204

6. Protein automated matches [190341] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187167] (1 PDB entry)

8. Domain d2ot3a_: 2ot3 A: [139311]
   Other proteins in same PDB: d2ot3b1
   automated match to d1txua_

Details for d2ot3a_

PDB Entry: 2ot3, 2.1 Å

PDB Description: crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21

PDB Compounds: (A:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d2ot3a_:

Sequence; same for both SEQRES and ATOM records:

>d2ot3a_ a.222.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaermqtrgk
vppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqmlcvpvn
edipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasaddflpt
liyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqslnlsq
edfdrymsgqtsp

Timeline for d2ot3a_:

• d2ot3a_ first appeared in SCOP 1.73, called d2ot3a1
  
• d2ot3a_ appears in SCOPe 2.04
  
• d2ot3a_ appears in SCOPe 2.06
  
• d2ot3a_ appears in the current release, SCOPe 2.08