SCOP 1.73: Domain d2ot3a1: 2ot3 A:139-387

Lineage for d2ot3a1 (2ot3 A:139-387)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.222: VPS9 domain [109992] (1 superfamily)
   multihelical; consist of two subdomains

4. Superfamily a.222.1: VPS9 domain [109993] (1 family)

5. Family a.222.1.1: VPS9 domain [109994] (1 protein)
   Pfam PF02204

6. Protein Rab5 GDP/GTP exchange factor (Rabex-5) [109995] (1 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109996] (2 PDB entries)

8. Domain d2ot3a1: 2ot3 A:139-387 [139311]
   automatically matched to d1txua_

Details for d2ot3a1

PDB Entry: 2ot3, 2.1 Å

PDB Description: crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21

PDB Compounds: (A:) Rab5 GDP/GTP exchange factor

SCOP Domain Sequences for d2ot3a1:

Sequence; same for both SEQRES and ATOM records:

>d2ot3a1 a.222.1.1 (A:139-387) Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
skefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaermqtrgk
vppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqmlcvpvn
edipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasaddflpt
liyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqslnlsq
edfdrymsg

Timeline for d2ot3a1:

• d2ot3a1 is new in SCOP 1.73
  
• d2ot3a1 appears in SCOP 1.75
  
• d2ot3a1 appears in the current release, SCOPe 2.08, called d2ot3a_