![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.222: VPS9 domain [109992] (1 superfamily) multihelical; consist of two subdomains |
![]() | Superfamily a.222.1: VPS9 domain [109993] (1 family) ![]() |
![]() | Family a.222.1.1: VPS9 domain [109994] (2 proteins) Pfam PF02204 |
![]() | Protein automated matches [190341] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187167] (1 PDB entry) |
![]() | Domain d2ot3a_: 2ot3 A: [139311] Other proteins in same PDB: d2ot3b1 automated match to d1txua_ |
PDB Entry: 2ot3 (more details), 2.1 Å
SCOPe Domain Sequences for d2ot3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ot3a_ a.222.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaermqtrgk vppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqmlcvpvn edipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasaddflpt liyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqslnlsq edfdrymsgqtsp
Timeline for d2ot3a_: