Lineage for d2ot3a_ (2ot3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737770Fold a.222: VPS9 domain [109992] (1 superfamily)
    multihelical; consist of two subdomains
  4. 2737771Superfamily a.222.1: VPS9 domain [109993] (1 family) (S)
  5. 2737772Family a.222.1.1: VPS9 domain [109994] (2 proteins)
    Pfam PF02204
  6. 2737776Protein automated matches [190341] (1 species)
    not a true protein
  7. 2737777Species Human (Homo sapiens) [TaxId:9606] [187167] (1 PDB entry)
  8. 2737778Domain d2ot3a_: 2ot3 A: [139311]
    Other proteins in same PDB: d2ot3b1
    automated match to d1txua_

Details for d2ot3a_

PDB Entry: 2ot3 (more details), 2.1 Å

PDB Description: crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21
PDB Compounds: (A:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d2ot3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ot3a_ a.222.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skefieflktfhktgqeiykqtklflegmhykrdlsieeqsecaqdfyhnvaermqtrgk
vppervekimdqiekyimtrlykyvfcpettddekkdlaiqkriralrwvtpqmlcvpvn
edipevsdmvvkaitdiiemdskrvprdklacitkcskhifnaikitknepasaddflpt
liyivlkgnpprlqsniqyitrfcnpsrlmtgedgyyftnlccavafiekldaqslnlsq
edfdrymsgqtsp

SCOPe Domain Coordinates for d2ot3a_:

Click to download the PDB-style file with coordinates for d2ot3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ot3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ot3b1