Lineage for d2ot0d1 (2ot0 D:1-363)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817253Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 817440Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)
  7. 817509Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (15 PDB entries)
  8. 817541Domain d2ot0d1: 2ot0 D:1-363 [139306]
    automatically matched to 1ZAH A:1-363

Details for d2ot0d1

PDB Entry: 2ot0 (more details), 2.05 Å

PDB Description: Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal peptide of Wiskott-Aldrich syndrome protein
PDB Compounds: (D:) Fructose-bisphosphate aldolase A

SCOP Domain Sequences for d2ot0d1:

Sequence, based on SEQRES records: (download)

>d2ot0d1 c.1.10.1 (D:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

Sequence, based on observed residues (ATOM records): (download)

>d2ot0d1 c.1.10.1 (D:1-363) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsnhay

SCOP Domain Coordinates for d2ot0d1:

Click to download the PDB-style file with coordinates for d2ot0d1.
(The format of our PDB-style files is described here.)

Timeline for d2ot0d1: