Lineage for d2osll1 (2osl L:2-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1756616Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1757132Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 1757146Domain d2osll1: 2osl L:2-106 [139298]
    Other proteins in same PDB: d2oslb2, d2osll2
    automatically matched to d1dqdl1

Details for d2osll1

PDB Entry: 2osl (more details), 2.6 Å

PDB Description: crystal structure of rituximab fab in complex with an epitope peptide
PDB Compounds: (L:) light chain of the Rituximab Fab fragment

SCOPe Domain Sequences for d2osll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2osll1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
ivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvrf
sgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleik

SCOPe Domain Coordinates for d2osll1:

Click to download the PDB-style file with coordinates for d2osll1.
(The format of our PDB-style files is described here.)

Timeline for d2osll1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2osll2