SCOPe 2.02: Domain d2osll1: 2osl L:2-106

Lineage for d2osll1 (2osl L:2-106)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (44 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2osll1: 2osl L:2-106 [139298]
   Other proteins in same PDB: d2oslb2, d2osll2
   automatically matched to d1dqdl1

Details for d2osll1

PDB Entry: 2osl, 2.6 Å

PDB Description: crystal structure of rituximab fab in complex with an epitope peptide

PDB Compounds: (L:) light chain of the Rituximab Fab fragment

SCOPe Domain Sequences for d2osll1:

Sequence; same for both SEQRES and ATOM records:

>d2osll1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
ivlsqspailsaspgekvtmtcrasssvsyihwfqqkpgsspkpwiyatsnlasgvpvrf
sgsgsgtsysltisrveaedaatyycqqwtsnpptfgggtkleik

Timeline for d2osll1:

• d2osll1 first appeared in SCOP 1.73
  
• d2osll1 appears in SCOPe 2.01
  
• d2osll1 appears in SCOPe 2.03
  
• d2osll1 appears in the current release, SCOPe 2.08