Lineage for d2os9c1 (2os9 C:235-355)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443311Domain d2os9c1: 2os9 C:235-355 [139294]
    Other proteins in same PDB: d2os9a2, d2os9b2, d2os9c2
    complexed with ca, ins

Details for d2os9c1

PDB Entry: 2os9 (more details), 1.7 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with myoinositol
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2os9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2os9c1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2os9c1:

Click to download the PDB-style file with coordinates for d2os9c1.
(The format of our PDB-style files is described here.)

Timeline for d2os9c1: