Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries) |
Domain d2os9c1: 2os9 C:235-355 [139294] Other proteins in same PDB: d2os9a2, d2os9b2, d2os9c2 complexed with ca, ins |
PDB Entry: 2os9 (more details), 1.7 Å
SCOPe Domain Sequences for d2os9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2os9c1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d2os9c1:
View in 3D Domains from other chains: (mouse over for more information) d2os9a1, d2os9a2, d2os9b1, d2os9b2 |