Lineage for d2os9b1 (2os9 B:236-355)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878360Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 878361Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries)
  8. 878369Domain d2os9b1: 2os9 B:236-355 [139292]
    Other proteins in same PDB: d2os9a2, d2os9b2, d2os9c2
    automatically matched to d1b08a1
    complexed with ca, ins

Details for d2os9b1

PDB Entry: 2os9 (more details), 1.7 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with myoinositol
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2os9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2os9b1 d.169.1.1 (B:236-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
ngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsm
tdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef

SCOP Domain Coordinates for d2os9b1:

Click to download the PDB-style file with coordinates for d2os9b1.
(The format of our PDB-style files is described here.)

Timeline for d2os9b1: