Lineage for d2os7e1 (2os7 E:9-147)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111329Protein Chaperone protein Caf1m [89205] (1 species)
  7. 1111330Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries)
  8. 1111338Domain d2os7e1: 2os7 E:9-147 [139286]
    Other proteins in same PDB: d2os7a2, d2os7b2, d2os7c2, d2os7d2, d2os7e2, d2os7f2
    automatically matched to d1p5va1

Details for d2os7e1

PDB Entry: 2os7 (more details), 2.9 Å

PDB Description: Caf1M periplasmic chaperone tetramer
PDB Compounds: (E:) Chaperone protein Caf1M

SCOPe Domain Sequences for d2os7e1:

Sequence, based on SEQRES records: (download)

>d2os7e1 b.1.11.1 (E:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv
fvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records): (download)

>d2os7e1 b.1.11.1 (E:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf
rldakqqnslriaqaggvfprdkeslkwlcvkgipvgvfvqfainncikllvrpnel

SCOPe Domain Coordinates for d2os7e1:

Click to download the PDB-style file with coordinates for d2os7e1.
(The format of our PDB-style files is described here.)

Timeline for d2os7e1: