![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) ![]() |
![]() | Family b.7.2.1: Periplasmic chaperone C-domain [49585] (4 proteins) |
![]() | Protein Caf1m [89221] (1 species) chaperone of F1 capsule antigen Caf1 |
![]() | Species Yersinia pestis [TaxId:632] [89222] (4 PDB entries) |
![]() | Domain d2os7d2: 2os7 D:148-232 [139285] Other proteins in same PDB: d2os7a1, d2os7b1, d2os7c1, d2os7d1, d2os7e1, d2os7f1 automatically matched to d1p5ua2 |
PDB Entry: 2os7 (more details), 2.9 Å
SCOP Domain Sequences for d2os7d2:
Sequence, based on SEQRES records: (download)
>d2os7d2 b.7.2.1 (D:148-232) Caf1m {Yersinia pestis [TaxId: 632]} kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg lagarnvswriindqggldrlyskn
>d2os7d2 b.7.2.1 (D:148-232) Caf1m {Yersinia pestis [TaxId: 632]} kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvs wriindqggldrlyskn
Timeline for d2os7d2: