Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (5 proteins) |
Protein Chaperone protein Caf1m [89205] (1 species) |
Species Yersinia pestis [TaxId:632] [89206] (4 PDB entries) |
Domain d2os7d1: 2os7 D:9-147 [139284] Other proteins in same PDB: d2os7a2, d2os7b2, d2os7c2, d2os7d2, d2os7e2, d2os7f2 automatically matched to d1p5va1 |
PDB Entry: 2os7 (more details), 2.9 Å
SCOPe Domain Sequences for d2os7d1:
Sequence, based on SEQRES records: (download)
>d2os7d1 b.1.11.1 (D:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} skeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplf rldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnpdkdvgv fvqfainncikllvrpnel
>d2os7d1 b.1.11.1 (D:9-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]} skeygvtigesriiypldaagvmvsvkntqdypvliqsriypfvvtpplfrldakqqnsl riaqaggvfprdkeslkwlcvkgipqkfnpdkdvgvfvqfainncikllvrpnel
Timeline for d2os7d1: