SCOPe 2.08: Domain d2os7c1: 2os7 C:3-147

Lineage for d2os7c1 (2os7 C:3-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (3 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
   automatically mapped to Pfam PF00345

6. Protein Chaperone protein Caf1m [89205] (1 species)

7. Species Yersinia pestis [TaxId:632] [89206] (8 PDB entries)

8. Domain d2os7c1: 2os7 C:3-147 [139282]
   Other proteins in same PDB: d2os7a2, d2os7b2, d2os7c2, d2os7d2, d2os7e2, d2os7f2
   automated match to d1p5va1

Details for d2os7c1

PDB Entry: 2os7, 2.9 Å

PDB Description: Caf1M periplasmic chaperone tetramer

PDB Compounds: (C:) Chaperone protein Caf1M

SCOPe Domain Sequences for d2os7c1:

Sequence, based on SEQRES records:

>d2os7c1 b.1.11.1 (C:3-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
pdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfv
vtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkfnp
dkdvgvfvqfainncikllvrpnel

Sequence, based on observed residues (ATOM records):

>d2os7c1 b.1.11.1 (C:3-147) Chaperone protein Caf1m {Yersinia pestis [TaxId: 632]}
pdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfv
vtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgipvgvfvqfainncikllvrp
nel

Timeline for d2os7c1:

• d2os7c1 first appeared in SCOP 1.73
  
• d2os7c1 appears in SCOPe 2.07