| Class b: All beta proteins [48724] (174 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) ![]() |
| Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
| Protein Caf1m [89221] (1 species) chaperone of F1 capsule antigen Caf1 |
| Species Yersinia pestis [TaxId:632] [89222] (4 PDB entries) |
| Domain d2os7b2: 2os7 B:148-233 [139281] Other proteins in same PDB: d2os7a1, d2os7b1, d2os7c1, d2os7d1, d2os7e1, d2os7f1 automatically matched to d1p5ua2 |
PDB Entry: 2os7 (more details), 2.9 Å
SCOPe Domain Sequences for d2os7b2:
Sequence, based on SEQRES records: (download)
>d2os7b2 b.7.2.1 (B:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknv
>d2os7b2 b.7.2.1 (B:148-233) Caf1m {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlnvs
wriindqggldrlysknv
Timeline for d2os7b2: