| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins) N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684) |
| Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [117560] (2 PDB entries) Uniprot P04183 18-191 |
| Domain d2orvb1: 2orv B:18-150 [139276] Other proteins in same PDB: d2orva2, d2orvb2 automated match to d1xbta1 complexed with 4ta, zn |
PDB Entry: 2orv (more details), 2.3 Å
SCOPe Domain Sequences for d2orvb1:
Sequence, based on SEQRES records: (download)
>d2orvb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt
>d2orvb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdmealpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt
Timeline for d2orvb1: