Lineage for d2orvb1 (2orv B:18-150)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871486Family c.37.1.24: Type II thymidine kinase [117558] (2 proteins)
    N-terminal part of Pfam PF00265; parallel beta-sheet of 6 strands, order 324516; topological similarity to the RecA-like proteins, especially CobA (52684)
  6. 2871487Protein Thymidine kinase, TK1, N-terminal domain [117559] (4 species)
  7. 2871491Species Human (Homo sapiens) [TaxId:9606] [117560] (2 PDB entries)
    Uniprot P04183 18-191
  8. 2871501Domain d2orvb1: 2orv B:18-150 [139276]
    Other proteins in same PDB: d2orva2, d2orvb2
    automated match to d1xbta1
    complexed with 4ta, zn

Details for d2orvb1

PDB Entry: 2orv (more details), 2.3 Å

PDB Description: human thymidine kinase 1 in complex with tp4a
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d2orvb1:

Sequence, based on SEQRES records: (download)

>d2orvb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdtrysssfcthdrntmealp
acllrdvaqealgvavigidegqffpdivefceamanagktvivaaldgtfqrkpfgail
nlvplaesvvklt

Sequence, based on observed residues (ATOM records): (download)

>d2orvb1 c.37.1.24 (B:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
rgqiqvilgpmfsgkstelmrrvrrfqiaqykclvikyakdmealpacllrdvaqealgv
avigidegqffpdivefceamanagktvivaaldgtfqrkpfgailnlvplaesvvklt

SCOPe Domain Coordinates for d2orvb1:

Click to download the PDB-style file with coordinates for d2orvb1.
(The format of our PDB-style files is described here.)

Timeline for d2orvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2orvb2