![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
![]() | Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
![]() | Protein Surfactant protein [57949] (2 species) |
![]() | Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (9 PDB entries) |
![]() | Domain d2orkc2: 2ork C:206-235 [139272] Other proteins in same PDB: d2orka1, d2orkb1, d2orkc1 automatically matched to d1m7la_ complexed with ca, ipd |
PDB Entry: 2ork (more details), 1.89 Å
SCOP Domain Sequences for d2orkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2orkc2 h.1.1.1 (C:206-235) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} slrqqvealqgqvqhlqaafsqykkvelfp
Timeline for d2orkc2:
![]() Domains from other chains: (mouse over for more information) d2orka1, d2orka2, d2orkb1, d2orkb2 |