SCOPe 2.08: Domain d2orka1: 2ork A:235-355

Lineage for d2orka1 (2ork A:235-355)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)

8. Domain d2orka1: 2ork A:235-355 [139267]
   Other proteins in same PDB: d2orka2, d2orkb2, d2orkc2
   complexed with ca, ipd

Details for d2orka1

PDB Entry: 2ork, 1.89 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein D in complex with inositol-1-phosphate

PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2orka1:

Sequence; same for both SEQRES and ATOM records:

>d2orka1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d2orka1:

• d2orka1 first appeared in SCOP 1.73
  
• d2orka1 appears in SCOPe 2.07