Lineage for d2orjc1 (2orj C:235-355)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608316Domain d2orjc1: 2orj C:235-355 [139265]
    Other proteins in same PDB: d2orja2, d2orjb2, d2orjc2
    complexed with bm3, ca

Details for d2orjc1

PDB Entry: 2orj (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with n-acetyl mannosamine
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2orjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2orjc1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d2orjc1:

Click to download the PDB-style file with coordinates for d2orjc1.
(The format of our PDB-style files is described here.)

Timeline for d2orjc1: