| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (8 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (28 proteins) Pfam PF00059 |
| Protein Surfactant protein, lectin domain [56461] (2 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (14 PDB entries) |
| Domain d2orjc1: 2orj C:236-355 [139265] Other proteins in same PDB: d2orja2, d2orjb2, d2orjc2 automatically matched to d1b08a1 complexed with bm3, ca |
PDB Entry: 2orj (more details), 1.8 Å
SCOP Domain Sequences for d2orjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2orjc1 d.169.1.1 (C:236-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
ngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsm
tdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef
Timeline for d2orjc1:
View in 3DDomains from other chains: (mouse over for more information) d2orja1, d2orja2, d2orjb1, d2orjb2 |