SCOPe 2.08: Domain d2orjb2: 2orj B:205-234

Lineage for d2orjb2 (2orj B:205-234)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (3 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)

8. Domain d2orjb2: 2orj B:205-234 [139264]
   Other proteins in same PDB: d2orja1, d2orjb1, d2orjc1
   complexed with bm3, ca

Details for d2orjb2

PDB Entry: 2orj, 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with n-acetyl mannosamine

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d2orjb2:

Sequence; same for both SEQRES and ATOM records:

>d2orjb2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d2orjb2:

• d2orjb2 first appeared in SCOP 1.73
  
• d2orjb2 appears in SCOPe 2.07