Lineage for d2or4a1 (2or4 A:594-750)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327716Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2327748Superfamily a.48.2: Transferrin receptor-like dimerisation domain [47672] (1 family) (S)
    automatically mapped to Pfam PF04253
  5. 2327749Family a.48.2.1: Transferrin receptor-like dimerisation domain [47673] (2 proteins)
  6. 2327750Protein Glutamate carboxypeptidase II [140574] (1 species)
  7. 2327751Species Human (Homo sapiens) [TaxId:9606] [140575] (34 PDB entries)
    Uniprot Q04609 594-750
  8. 2327754Domain d2or4a1: 2or4 A:594-750 [139258]
    Other proteins in same PDB: d2or4a2, d2or4a3
    automatically matched to 2C6C A:594-750
    complexed with ca, cl, nag, qus, zn

Details for d2or4a1

PDB Entry: 2or4 (more details), 1.62 Å

PDB Description: a high resolution crystal structure of human glutamate carboxypeptidase ii in complex with quisqualic acid
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d2or4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2or4a1 a.48.2.1 (A:594-750) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
pfdcrdyavvlrkyadkiysismkhpqemktysvsfdslfsavknfteiaskfserlqdf
dksnpivlrmmndqlmflerafidplglpdrpfyrhviyapsshnkyagesfpgiydalf
dieskvdpskawgevkrqiyvaaftvqaaaetlseva

SCOPe Domain Coordinates for d2or4a1:

Click to download the PDB-style file with coordinates for d2or4a1.
(The format of our PDB-style files is described here.)

Timeline for d2or4a1: