SCOP 1.73: Domain d2or3b1: 2or3 B:2-188

Lineage for d2or3b1 (2or3 B:2-188)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (10 PDB entries)

8. Domain d2or3b1: 2or3 B:2-188 [139257]
   automatically matched to d1pdwg_
   complexed with so4

Details for d2or3b1

PDB Entry: 2or3, 1.2 Å

PDB Description: Pre-oxidation Complex of Human DJ-1

PDB Compounds: (B:) Protein DJ-1

SCOP Domain Sequences for d2or3b1:

Sequence; same for both SEQRES and ATOM records:

>d2or3b1 c.23.16.2 (B:2-188) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d2or3b1:

• d2or3b1 is new in SCOP 1.73
  
• d2or3b1 appears in SCOP 1.75
  
• d2or3b1 appears in the current release, SCOPe 2.08, called d2or3b_