Lineage for d2or3a_ (2or3 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. Species Human (Homo sapiens) [TaxId:9606] [89604] (62 PDB entries)
    Uniprot Q99497
  8. Domain d2or3a_: 2or3 A: [139256]
    automated match to d1ps4a_
    complexed with so4

Details for d2or3a_

PDB Entry: 2or3 (more details), 1.2 Å

PDB Description: Pre-oxidation Complex of Human DJ-1
PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d2or3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2or3a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d2or3a_ are not available.

Timeline for d2or3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2or3b_