Lineage for d2oqza1 (2oqz A:35-253)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679195Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. 679196Superfamily b.100.1: Sortase [63817] (1 family) (S)
  5. 679197Family b.100.1.1: Sortase [63818] (3 proteins)
  6. 679198Protein Hypothetical protein BA4783 [110281] (1 species)
  7. 679199Species Bacillus anthracis [TaxId:1392] [110282] (3 PDB entries)
  8. 679200Domain d2oqza1: 2oqz A:35-253 [139255]
    automatically matched to d1rz2a_
    complexed with acy, cs4

Details for d2oqza1

PDB Entry: 2oqz (more details), 1.6 Å

PDB Description: the crystal structure of sortase b from b.anthracis in complex with aaek2
PDB Compounds: (A:) sortase B

SCOP Domain Sequences for d2oqza1:

Sequence, based on SEQRES records: (download)

>d2oqza1 b.100.1.1 (A:35-253) Hypothetical protein BA4783 {Bacillus anthracis [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyaldpeagrlvvhaklvkr

Sequence, based on observed residues (ATOM records): (download)

>d2oqza1 b.100.1.1 (A:35-253) Hypothetical protein BA4783 {Bacillus anthracis [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyagrlvvhaklvkr

SCOP Domain Coordinates for d2oqza1:

Click to download the PDB-style file with coordinates for d2oqza1.
(The format of our PDB-style files is described here.)

Timeline for d2oqza1: