Lineage for d2oqza_ (2oqz A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.100: Sortase [63816] (1 superfamily)
    barrel, closed; n=8, S=10; mixed sheet; two overside connections
  4. Superfamily b.100.1: Sortase [63817] (2 families) (S)
  5. Family b.100.1.1: Sortase [63818] (3 proteins)
  6. Protein Hypothetical protein BA4783 [110281] (1 species)
  7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [110282] (3 PDB entries)
    Uniprot Q81L49
  8. Domain d2oqza_: 2oqz A: [139255]
    automated match to d1rz2a_
    complexed with acy

Details for d2oqza_

PDB Entry: 2oqz (more details), 1.6 Å

PDB Description: the crystal structure of sortase b from b.anthracis in complex with aaek2
PDB Compounds: (A:) sortase B

SCOPe Domain Sequences for d2oqza_:

Sequence, based on SEQRES records: (download)

>d2oqza_ b.100.1.1 (A:) Hypothetical protein BA4783 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyaldpeagrlvvhaklvkrq

Sequence, based on observed residues (ATOM records): (download)

>d2oqza_ b.100.1.1 (A:) Hypothetical protein BA4783 {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
ifmdyyenrkvmaeaqniyekspmeeqsqdgevrkqfkalqqinqeivgwitmddtqiny
pivqakdndyylfrnykgedmragsifmdyrndvksqnrntilyghrmkdgsmfgslkkm
ldeeffmshrklyydtlfegydlevfsvyttttdfyyietdfssdteytsflekiqeksl
yktdttvtagdqivtlstcdyagrlvvhaklvkrq

SCOPe Domain Coordinates for d2oqza_ are not available.

Timeline for d2oqza_: