Lineage for d2oqua1 (2oqu A:1-240)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 670328Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 670617Protein Elastase [50536] (4 species)
  7. 670625Species Pig (Sus scrofa) [TaxId:9823] [50538] (91 PDB entries)
  8. 670682Domain d2oqua1: 2oqu A:1-240 [139249]
    automatically matched to d1c1ma_
    complexed with ca, so4, xe

Details for d2oqua1

PDB Entry: 2oqu (more details), 1.8 Å

PDB Description: High Pressure Cryocooling of Capillary Sample Cryoprotection and Diffraction Phasing at Long Wavelengths
PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2oqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oqua1 b.47.1.2 (A:1-240) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d2oqua1:

Click to download the PDB-style file with coordinates for d2oqua1.
(The format of our PDB-style files is described here.)

Timeline for d2oqua1: