SCOP 1.73: Domain d2oqna1: 2oqn A:1-207

Lineage for d2oqna1 (2oqn A:1-207)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (18 PDB entries)

8. Domain d2oqna1: 2oqn A:1-207 [139248]
   automatically matched to d1kwna_
   complexed with tar

Details for d2oqna1

PDB Entry: 2oqn, 1.9 Å

PDB Description: High Pressure Cryocooling of Capillary Sample Cryoprotection and Diffraction Phasing at Long Wavelengths

PDB Compounds: (A:) Thaumatin-1

SCOP Domain Sequences for d2oqna1:

Sequence; same for both SEQRES and ATOM records:

>d2oqna1 b.25.1.1 (A:1-207) Thaumatin {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d2oqna1:

• d2oqna1 is new in SCOP 1.73
  
• d2oqna1 appears in SCOP 1.75
  
• d2oqna1 appears in the current release, SCOPe 2.08, called d2oqna_