SCOPe 2.08: Domain d2oqna_: 2oqn A:

Lineage for d2oqna_ (2oqn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
   automatically mapped to Pfam PF00314

6. Protein automated matches [190195] (6 species)
   not a true protein

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)

8. Domain d2oqna_: 2oqn A: [139248]
   automated match to d1kwna_
   complexed with tar

Details for d2oqna_

PDB Entry: 2oqn, 1.9 Å

PDB Description: High Pressure Cryocooling of Capillary Sample Cryoprotection and Diffraction Phasing at Long Wavelengths

PDB Compounds: (A:) Thaumatin-1

SCOPe Domain Sequences for d2oqna_:

Sequence; same for both SEQRES and ATOM records:

>d2oqna_ b.25.1.1 (A:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d2oqna_:

• d2oqna_ first appeared in SCOP 1.73, called d2oqna1
  
• d2oqna_ appears in SCOPe 2.07